PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 104135
Common NameMICPUN_104135
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas
Family HB-other
Protein Properties Length: 324aa    MW: 34505.5 Da    PI: 10.0304
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
104135genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.22.8e-082733052254
               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               ++yp+ e++ +LA+  g+t +qV +WF N R +
    104135 273 KPYPDDEDKVKLAEASGMTRAQVGNWFINARVR 305
               69*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.4E-5252313IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.3E-21256311IPR009057Homeodomain-like
SuperFamilySSF466891.58E-13259313IPR009057Homeodomain-like
PROSITE profilePS5007110.414263309IPR001356Homeobox domain
PfamPF059201.5E-16266305IPR008422Homeobox KN domain
CDDcd000863.15E-10267310No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MIGGPSVDAD ADADVLSSAL PTHVSKAAHD PVVAKPPSAR ARVPRRDTPR SPLTRDLFDG  60
GHGTSESDDL DEDDLAAIAR GLEQRTAALK LGVRATHARR IGAVDAALAK LQLAVAGADG  120
AKVHPNTHRA TTSTRLDATD NTHTHADGHR ARSQQDARDR RRLLNRVGVD LAATSRSFGS  180
AVDARVRDAS NKVLRGAPSR FAAEAAASGV ITVGTTTNDK NAKAKGPGGS TKSVKIKPVA  240
DDPDAEVTGE LKFNAQSVKT QPLRDWLLAH FDKPYPDDED KVKLAEASGM TRAQVGNWFI  300
NARVRIWRPM VLRLGEEIER ESD*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0013320.0CP001332.1 Micromonas sp. RCC299 chromosome 14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002506210.10.0predicted protein
TrEMBLC1EH960.0C1EH96_MICSR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP321077
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27220.14e-19BEL1-like homeodomain 5
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]